PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0214s0100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family TALE
Protein Properties Length: 478aa    MW: 53812.9 Da    PI: 9.5719
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0214s0100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox34.53.6e-112973341954
                             HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                             Fe   ++yp+ +e++ LA+++gL+ +qV++WF N R +
  SapurV1A.0214s0100.1.p 297 FEHflHPYPTDSEKQALAQQTGLSRTQVSNWFINARVR 334
                             665559******************************88 PP

2BELL85.56.4e-28164234272
                    BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                             r e+q k +kL+ +l+eV++rYk y++q+q v++sFe+vaglg+a+pY+  A k + +hF +Lk+a+ ++i
  SapurV1A.0214s0100.1.p 164 RVEHQCKNSKLIWMLDEVYRRYKLYCQQMQSVVASFETVAGLGNAAPYVCYAIKIVLKHFNSLKNALLDKI 234
                             789****************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005745.9E-31110232IPR006563POX domain
PfamPF075261.1E-29115230IPR006563POX domain
CDDcd000864.50E-12278339No hitNo description
SMARTSM003894.4E-12278342IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.1E-28281342IPR009057Homeodomain-like
SuperFamilySSF466895.13E-18282346IPR009057Homeodomain-like
PfamPF059201.1E-18295334IPR008422Homeobox KN domain
PROSITE profilePS5007112.406297338IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 478 aa     Download sequence    Send to blast
MAQNFEPFHV PQQNRKNKLR VTSQSNQEQQ NPPTPLYSRQ AFMSPSQSSS FFPLQTLKDM  60
SHQPLSSQGL SLSLSFQLDN QRHNAVSVSG DYLKQNGEMK STVVPLGPFT GYASILNSSR  120
FLKPAQQILD DICGVINCAN ANPPLDGLSE SEIARERIAF LSDRVEHQCK NSKLIWMLDE  180
VYRRYKLYCQ QMQSVVASFE TVAGLGNAAP YVCYAIKIVL KHFNSLKNAL LDKIQFTGKN  240
FDGSSVTMEK NPRHGTNERG LRNQDPTLNL NFTQHPVWRS QRGLPGHAVA VLKTWLFEHF  300
LHPYPTDSEK QALAQQTGLS RTQVSNWFIN ARVRLWKPMV EEVHMLESQQ TQAPFSTVTQ  360
GGGMPSDLPL EKQPRTTQHQ NTNQTKRCRK ELPNVSKQRQ EPRNICVKNL SGNYHSTGVS  420
GSRGVSLALG LPQNNRIDQS WPLPMSMPHH VNLEMISMMD SAPGTGFELQ KQHFGED*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B1e-15284342563Homeobox protein Meis2
3k2a_A1e-15284342563Homeobox protein Meis2
4xrm_B1e-15284342563Homeobox protein Meis2
4xrm_A1e-15284342563Homeobox protein Meis2
1x2n_A1e-15279335865Homeobox protein PKNOX1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011036837.10.0PREDICTED: BEL1-like homeodomain protein 9
SwissprotQ9LZM82e-71BLH9_ARATH; BEL1-like homeodomain protein 9
TrEMBLB9HT490.0B9HT49_POPTR; Uncharacterized protein
STRINGPOPTR_0008s06130.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28103373
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.11e-72TALE family protein